Lineage for d5dg4c_ (5dg4 C:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2804246Fold b.60: Lipocalins [50813] (1 superfamily)
    barrel, closed or opened; n=8, S=12; meander
  4. 2804247Superfamily b.60.1: Lipocalins [50814] (10 families) (S)
    bind hydrophobic ligands in their interior
  5. 2804862Family b.60.1.2: Fatty acid binding protein-like [50847] (18 proteins)
    ten-stranded meander beta-sheet folded upon itself
    relates to the common fold by opening the barrel and insertion of beta-hairpin
  6. 2805235Protein automated matches [190295] (6 species)
    not a true protein
  7. 2805251Species Human (Homo sapiens) [TaxId:9606] [187133] (90 PDB entries)
  8. 2805328Domain d5dg4c_: 5dg4 C: [322988]
    automated match to d4zcbb_
    complexed with act

Details for d5dg4c_

PDB Entry: 5dg4 (more details), 1.5 Å

PDB Description: crystal structure of monomer human cellular retinol binding protein ii-y60l
PDB Compounds: (C:) Retinol-binding protein 2

SCOPe Domain Sequences for d5dg4c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5dg4c_ b.60.1.2 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
trdqngtwemesnenfegymkaldidfatrkiavrltqtkvidqdgdnfktkttstfrnl
dvdftvgvefdeytksldnrhvkalvtwegdvlvcvqkgekenrgwkqwiegdklylelt
cgdqvcrqvfkkk

SCOPe Domain Coordinates for d5dg4c_:

Click to download the PDB-style file with coordinates for d5dg4c_.
(The format of our PDB-style files is described here.)

Timeline for d5dg4c_: