| Class b: All beta proteins [48724] (177 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.18: E set domains [81296] (24 families) ![]() "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies |
| Family b.1.18.0: automated matches [191341] (1 protein) not a true family |
| Protein automated matches [190226] (55 species) not a true protein |
| Species Bacillus amyloliquefaciens [TaxId:1390] [197052] (4 PDB entries) |
| Domain d5ijub_: 5iju B: [322987] automated match to d2bena_ complexed with ca, cu, edo |
PDB Entry: 5iju (more details), 1.7 Å
SCOPe Domain Sequences for d5ijub_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5ijub_ b.1.18.0 (B:) automated matches {Bacillus amyloliquefaciens [TaxId: 1390]}
hgyikepvsraymgalekqtmgwtaaaqkygsvidnpqsvegpkgfpaagppdgriasan
ggsgqidfgldkqtadhwvkqnirggfntftwhytaphatskwhyyitkknwnpnkplsr
defeligtvnhdgskadtnlthkifvptdrsgyhiilgvwdvadtsnafynvidvnlt
Timeline for d5ijub_: