SCOPe 2.08: Domain d5ijub_: 5iju B:

Lineage for d5ijub_ (5iju B:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.18: E set domains [81296] (27 families)
   "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies

5. Family b.1.18.0: automated matches [191341] (1 protein)
   not a true family

6. Protein automated matches [190226] (81 species)
   not a true protein

7. Species Bacillus amyloliquefaciens [TaxId:1390] [197052] (4 PDB entries)

8. Domain d5ijub_: 5iju B: [322987]
   automated match to d2bena_
   complexed with ca, cu, edo

Details for d5ijub_

PDB Entry: 5iju, 1.7 Å

PDB Description: structure of an aa10 lytic polysaccharide monooxygenase from bacillus amyloliquefaciens with cu(ii) bound

PDB Compounds: (B:) BaAA10 Lytic Polysaccharide Monooxygenase

SCOPe Domain Sequences for d5ijub_:

Sequence; same for both SEQRES and ATOM records:

>d5ijub_ b.1.18.0 (B:) automated matches {Bacillus amyloliquefaciens [TaxId: 1390]}
hgyikepvsraymgalekqtmgwtaaaqkygsvidnpqsvegpkgfpaagppdgriasan
ggsgqidfgldkqtadhwvkqnirggfntftwhytaphatskwhyyitkknwnpnkplsr
defeligtvnhdgskadtnlthkifvptdrsgyhiilgvwdvadtsnafynvidvnlt

Timeline for d5ijub_:

• d5ijub_ first appeared in SCOPe 2.06
  
• d5ijub_ appears in SCOPe 2.07