Class a: All alpha proteins [46456] (290 folds) |
Fold a.3: Cytochrome c [46625] (1 superfamily) core: 3 helices; folded leaf, opened |
Superfamily a.3.1: Cytochrome c [46626] (9 families) covalently-bound heme completes the core |
Family a.3.1.1: monodomain cytochrome c [46627] (16 proteins) |
Protein automated matches [190113] (17 species) not a true protein |
Species Norway rat (Rattus norvegicus) [TaxId:10116] [322473] (5 PDB entries) |
Domain d5c0za_: 5c0z A: [322983] automated match to d2b4za_ complexed with fc6, hec |
PDB Entry: 5c0z (more details), 1.12 Å
SCOPe Domain Sequences for d5c0za_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5c0za_ a.3.1.1 (A:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]} gdvekgkkifvqkcaqchtvekggkhktgpnlhglfgrktgqaagfsytdanknkgitwg edtlmeylenpkkyipgtkmifagikkkgeradliaylkkatne
Timeline for d5c0za_: