Lineage for d1e0kc_ (1e0k C:)
- Root: SCOP 1.55
Class c: Alpha and beta proteins (a/b) [51349] (97 folds) 
Fold c.37: P-loop containing nucleotide triphosphate hydrolases [52539] (1 superfamily) Superfamily c.37.1: P-loop containing nucleotide triphosphate hydrolases [52540] (14 families) 
- Family c.37.1.11: RecA protein-like (ATPase-domain) [52670] (6 proteins)
Protein Gene 4 protein (g4p, DNA primase), helicase domain [52674] (1 species) Species Bacteriophage T7 [TaxId:10760] [52675] (6 PDB entries) 
Domain d1e0kc_: 1e0k C: [32298]
Details for d1e0kc_
PDB Entry: 1e0k (more details), 3.3 Å
PDB Description: gp4d helicase from phage t7
SCOP Domain Sequences for d1e0kc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1e0kc_ c.37.1.11 (C:) Gene 4 protein (g4p, DNA primase), helicase domain {Bacteriophage T7}
pdgvvsalslrerirehlsseesvgllfsgctgindktlgarggevimvtsgsgmgkstf
vrqqalqwgtamgkkvglamleesveetaedliglhnrvrlrqsdslkreiiengkfdqw
fdelfgndtfhlydsfaeaetdrllaklaymrsglgcdviildhisivvsasgesderkm
idnlmtklkgfakstgvvlvvichlknpdkgkaheegrpvsitdlrgsgalrqlsdtiia
lernqqgdmpnlvlvrilkcrftgdtgiagymeynketgwlepssysg
SCOP Domain Coordinates for d1e0kc_:
Click to download the PDB-style file with coordinates for d1e0kc_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1e0kc_:
- d1e0kc_ appears in SCOP 1.57
- d1e0kc_ appears in the current release, SCOPe 2.08
View in 3D
