Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
Protein automated matches [190374] (15 species) not a true protein |
Species Mouse (Mus musculus) [TaxId:10090] [224855] (650 PDB entries) |
Domain d5hdql2: 5hdq L:108-212 [322970] Other proteins in same PDB: d5hdqa_, d5hdqh1, d5hdqh2, d5hdql1 automated match to d1tqbc2 complexed with fe, gol |
PDB Entry: 5hdq (more details), 1.83 Å
SCOPe Domain Sequences for d5hdql2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5hdql2 b.1.1.2 (L:108-212) automated matches {Mouse (Mus musculus) [TaxId: 10090]} radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd skdstysmsstltltkdeyerhnsytceathktstspivksfnrn
Timeline for d5hdql2: