Lineage for d5ik2n3 (5ik2 N:350-462)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2325855Fold a.69: Left-handed superhelix [47916] (4 superfamilies)
    core: 4-5 helices; bundle; left-handed superhelix
  4. 2325856Superfamily a.69.1: C-terminal domain of alpha and beta (or A/B) subunits of rotary ATPases [47917] (3 families) (S)
  5. 2326080Family a.69.1.0: automated matches [254233] (1 protein)
    not a true family
  6. 2326081Protein automated matches [254528] (12 species)
    not a true protein
  7. 2326091Species Caldalkalibacillus thermarum [TaxId:986075] [322897] (2 PDB entries)
  8. 2326103Domain d5ik2n3: 5ik2 N:350-462 [322960]
    Other proteins in same PDB: d5ik2a1, d5ik2a2, d5ik2b1, d5ik2b2, d5ik2c1, d5ik2c2, d5ik2d1, d5ik2d2, d5ik2e1, d5ik2e2, d5ik2f1, d5ik2f2, d5ik2g_, d5ik2i1, d5ik2i2, d5ik2j1, d5ik2j2, d5ik2k1, d5ik2k2, d5ik2l1, d5ik2l2, d5ik2m1, d5ik2m2, d5ik2n1, d5ik2n2, d5ik2o_
    automated match to d2qe7d3
    complexed with adp, gol, mg, po4; mutant

Details for d5ik2n3

PDB Entry: 5ik2 (more details), 2.6 Å

PDB Description: caldalaklibacillus thermarum f1-atpase (epsilon mutant)
PDB Compounds: (N:) ATP synthase subunit beta

SCOPe Domain Sequences for d5ik2n3:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ik2n3 a.69.1.0 (N:350-462) automated matches {Caldalkalibacillus thermarum [TaxId: 986075]}
avvgeehyrvargvqqvlqryndlqdiiailgmdelsdedklivararkiqrflsqpfhv
aeqftgmpgkyvpvketvrgfkeilegkhdnlpeeafymvgtideavekakkl

SCOPe Domain Coordinates for d5ik2n3:

Click to download the PDB-style file with coordinates for d5ik2n3.
(The format of our PDB-style files is described here.)

Timeline for d5ik2n3: