Lineage for d5ik2n1 (5ik2 N:1-76)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2798607Fold b.49: Domain of alpha and beta subunits of F1 ATP synthase-like [50614] (4 superfamilies)
    barrel, closed; n=6, S=8; greek-key
    Many cradle-loop superfamilies may be homologous, according to PubMed 18457946
  4. 2798608Superfamily b.49.1: N-terminal domain of alpha and beta (or A/B) subunits of rotary ATPases [50615] (3 families) (S)
    automatically mapped to Pfam PF02874
  5. 2798831Family b.49.1.0: automated matches [254232] (1 protein)
    not a true family
  6. 2798832Protein automated matches [254527] (17 species)
    not a true protein
  7. 2798842Species Caldalkalibacillus thermarum [TaxId:986075] [322893] (2 PDB entries)
  8. 2798854Domain d5ik2n1: 5ik2 N:1-76 [322958]
    Other proteins in same PDB: d5ik2a2, d5ik2a3, d5ik2b2, d5ik2b3, d5ik2c2, d5ik2c3, d5ik2d2, d5ik2d3, d5ik2e2, d5ik2e3, d5ik2f2, d5ik2f3, d5ik2g_, d5ik2i2, d5ik2i3, d5ik2j2, d5ik2j3, d5ik2k2, d5ik2k3, d5ik2l2, d5ik2l3, d5ik2m2, d5ik2m3, d5ik2n2, d5ik2n3, d5ik2o_
    automated match to d2qe7d1
    complexed with adp, gol, mg, po4; mutant

Details for d5ik2n1

PDB Entry: 5ik2 (more details), 2.6 Å

PDB Description: caldalaklibacillus thermarum f1-atpase (epsilon mutant)
PDB Compounds: (N:) ATP synthase subunit beta

SCOPe Domain Sequences for d5ik2n1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ik2n1 b.49.1.0 (N:1-76) automated matches {Caldalkalibacillus thermarum [TaxId: 986075]}
mnkgriiqvmgpvvdiqfesgqlpdiynaitierpqggtltveaavhlgdnvvrcvamas
tdglvrgleavdtgap

SCOPe Domain Coordinates for d5ik2n1:

Click to download the PDB-style file with coordinates for d5ik2n1.
(The format of our PDB-style files is described here.)

Timeline for d5ik2n1: