Lineage for d1e0jf_ (1e0j F:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2473887Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2473888Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2477556Family c.37.1.11: RecA protein-like (ATPase-domain) [52670] (21 proteins)
    core: mixed beta-sheet of 8 strands, order 32451678; strand 7 is antiparallel to the rest
  6. 2477907Protein Gene 4 protein (g4p, DNA primase), helicase domain [52674] (1 species)
  7. 2477908Species Bacteriophage T7 [TaxId:10760] [52675] (7 PDB entries)
  8. 2477918Domain d1e0jf_: 1e0j F: [32295]
    protein/DNA complex; complexed with anp, mg

Details for d1e0jf_

PDB Entry: 1e0j (more details), 3 Å

PDB Description: gp4d helicase from phage t7 adpnp complex
PDB Compounds: (F:) DNA helicase

SCOPe Domain Sequences for d1e0jf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e0jf_ c.37.1.11 (F:) Gene 4 protein (g4p, DNA primase), helicase domain {Bacteriophage T7 [TaxId: 10760]}
pdgvvsalslrerirehlsseesvgllfsgctgindktlgarggevimvtsgsgmgkstf
vrqqalqwgtamgkkvglamleesveetaedliglhnrvrlrqsdslkreiiengkfdqw
fdelfgndtfhlydsfaeaetdrllaklaymrsglgcdviildhisivvsasgesderkm
idnlmtklkgfakstgvvlvvichlknpdkgkaheegrpvsitdlrgsgalrqlsdtiia
lernqqgdmpnlvlvrilkcrftgdtgiagymeynketgwlepssysg

SCOPe Domain Coordinates for d1e0jf_:

Click to download the PDB-style file with coordinates for d1e0jf_.
(The format of our PDB-style files is described here.)

Timeline for d1e0jf_: