Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) division into families based on beta-sheet topologies |
Family c.37.1.11: RecA protein-like (ATPase-domain) [52670] (21 proteins) core: mixed beta-sheet of 8 strands, order 32451678; strand 7 is antiparallel to the rest |
Protein Gene 4 protein (g4p, DNA primase), helicase domain [52674] (1 species) |
Species Bacteriophage T7 [TaxId:10760] [52675] (7 PDB entries) |
Domain d1e0jf_: 1e0j F: [32295] protein/DNA complex; complexed with anp, mg |
PDB Entry: 1e0j (more details), 3 Å
SCOPe Domain Sequences for d1e0jf_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1e0jf_ c.37.1.11 (F:) Gene 4 protein (g4p, DNA primase), helicase domain {Bacteriophage T7 [TaxId: 10760]} pdgvvsalslrerirehlsseesvgllfsgctgindktlgarggevimvtsgsgmgkstf vrqqalqwgtamgkkvglamleesveetaedliglhnrvrlrqsdslkreiiengkfdqw fdelfgndtfhlydsfaeaetdrllaklaymrsglgcdviildhisivvsasgesderkm idnlmtklkgfakstgvvlvvichlknpdkgkaheegrpvsitdlrgsgalrqlsdtiia lernqqgdmpnlvlvrilkcrftgdtgiagymeynketgwlepssysg
Timeline for d1e0jf_: