SCOP 1.61: Domain d1e0jf_: 1e0j F:

Lineage for d1e0jf_ (1e0j F:)

1. Root: SCOP 1.61

2. Class c: Alpha and beta proteins (a/b) [51349] (117 folds)

3. Fold c.37: P-loop containing nucleotide triphosphate hydrolases [52539] (1 superfamily)

4. Superfamily c.37.1: P-loop containing nucleotide triphosphate hydrolases [52540] (18 families)

5. Family c.37.1.11: RecA protein-like (ATPase-domain) [52670] (7 proteins)

6. Protein Gene 4 protein (g4p, DNA primase), helicase domain [52674] (1 species)

7. Species Bacteriophage T7 [TaxId:10760] [52675] (6 PDB entries)

8. Domain d1e0jf_: 1e0j F: [32295]

Details for d1e0jf_

PDB Entry: 1e0j, 3 Å

PDB Description: gp4d helicase from phage t7 adpnp complex

SCOP Domain Sequences for d1e0jf_:

Sequence; same for both SEQRES and ATOM records:

>d1e0jf_ c.37.1.11 (F:) Gene 4 protein (g4p, DNA primase), helicase domain {Bacteriophage T7}
pdgvvsalslrerirehlsseesvgllfsgctgindktlgarggevimvtsgsgmgkstf
vrqqalqwgtamgkkvglamleesveetaedliglhnrvrlrqsdslkreiiengkfdqw
fdelfgndtfhlydsfaeaetdrllaklaymrsglgcdviildhisivvsasgesderkm
idnlmtklkgfakstgvvlvvichlknpdkgkaheegrpvsitdlrgsgalrqlsdtiia
lernqqgdmpnlvlvrilkcrftgdtgiagymeynketgwlepssysg

Timeline for d1e0jf_:

• d1e0jf_ first appeared (with stable ids) in SCOP 1.55
  
• d1e0jf_ appears in SCOP 1.59
  
• d1e0jf_ appears in SCOP 1.63
  
• d1e0jf_ appears in the current release, SCOPe 2.08