SCOPe 2.07: Domain d5hkko_: 5hkk O:

Lineage for d5hkko_ (5hkk O:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.49: Pyruvate kinase C-terminal domain-like [52934] (2 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145, strand 5 is antiparallel to the rest

4. Superfamily c.49.2: ATP synthase (F1-ATPase), gamma subunit [52943] (2 families)
   contains an antiparallel coiled coil formed by N- and C-terminal extensions to the common fold

5. Family c.49.2.0: automated matches [191450] (1 protein)
   not a true family

6. Protein automated matches [190687] (6 species)
   not a true protein

7. Species Caldalkalibacillus thermarum [TaxId:986075] [322942] (2 PDB entries)

8. Domain d5hkko_: 5hkk O: [322943]
   Other proteins in same PDB: d5hkka1, d5hkka2, d5hkka3, d5hkkb1, d5hkkb2, d5hkkb3, d5hkkc1, d5hkkc2, d5hkkc3, d5hkkd1, d5hkkd2, d5hkkd3, d5hkke1, d5hkke2, d5hkke3, d5hkkf1, d5hkkf2, d5hkkf3, d5hkki1, d5hkki2, d5hkki3, d5hkkj1, d5hkkj2, d5hkkj3, d5hkkk1, d5hkkk2, d5hkkk3, d5hkkl1, d5hkkl2, d5hkkl3, d5hkkm1, d5hkkm2, d5hkkm3, d5hkkn1, d5hkkn2, d5hkkn3
   automated match to d2jdig_
   complexed with adp, atp, gol, mg, po4

Details for d5hkko_

PDB Entry: 5hkk, 3 Å

PDB Description: caldalaklibacillus thermarum f1-atpase (wild type)

PDB Compounds: (O:) ATP synthase gamma chain

SCOPe Domain Sequences for d5hkko_:

Sequence; same for both SEQRES and ATOM records:

>d5hkko_ c.49.2.0 (O:) automated matches {Caldalkalibacillus thermarum [TaxId: 986075]}
gmreikrrirsvkntrqitkamkmvaaaklrraqetaenarpyadkikevissiaagtkd
fshpmlearpvkktgymvitsdrglagpynanilrlvsktieerhqskdeyvifavgrkg
rdffkkrgypvveevtgisdtpslteiqdiaqsaigmfadetfdkltifynefvspivqr
pvekqllpltseevldgpvsayeyepdsesvlevllpkyaetliysalldakasefgarm
tamgnatdnatemletltlqfnrarqaaitqeiaeivaganalr

Timeline for d5hkko_:

• d5hkko_ first appeared in SCOPe 2.06
  
• d5hkko_ appears in the current release, SCOPe 2.08