Lineage for d5hkko_ (5hkk O:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2135454Fold c.49: Pyruvate kinase C-terminal domain-like [52934] (2 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145, strand 5 is antiparallel to the rest
  4. 2135614Superfamily c.49.2: ATP synthase (F1-ATPase), gamma subunit [52943] (2 families) (S)
    contains an antiparallel coiled coil formed by N- and C-terminal extensions to the common fold
  5. 2135659Family c.49.2.0: automated matches [191450] (1 protein)
    not a true family
  6. 2135660Protein automated matches [190687] (2 species)
    not a true protein
  7. 2135663Species Caldalkalibacillus thermarum [TaxId:986075] [322942] (2 PDB entries)
  8. 2135667Domain d5hkko_: 5hkk O: [322943]
    Other proteins in same PDB: d5hkka1, d5hkka2, d5hkka3, d5hkkb1, d5hkkb2, d5hkkb3, d5hkkc1, d5hkkc2, d5hkkc3, d5hkkd1, d5hkkd2, d5hkkd3, d5hkke1, d5hkke2, d5hkke3, d5hkkf1, d5hkkf2, d5hkkf3, d5hkki1, d5hkki2, d5hkki3, d5hkkj1, d5hkkj2, d5hkkj3, d5hkkk1, d5hkkk2, d5hkkk3, d5hkkl1, d5hkkl2, d5hkkl3, d5hkkm1, d5hkkm2, d5hkkm3, d5hkkn1, d5hkkn2, d5hkkn3
    automated match to d2jdig_
    complexed with adp, atp, gol, mg, po4

Details for d5hkko_

PDB Entry: 5hkk (more details), 3 Å

PDB Description: caldalaklibacillus thermarum f1-atpase (wild type)
PDB Compounds: (O:) ATP synthase gamma chain

SCOPe Domain Sequences for d5hkko_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5hkko_ c.49.2.0 (O:) automated matches {Caldalkalibacillus thermarum [TaxId: 986075]}
gmreikrrirsvkntrqitkamkmvaaaklrraqetaenarpyadkikevissiaagtkd
fshpmlearpvkktgymvitsdrglagpynanilrlvsktieerhqskdeyvifavgrkg
rdffkkrgypvveevtgisdtpslteiqdiaqsaigmfadetfdkltifynefvspivqr
pvekqllpltseevldgpvsayeyepdsesvlevllpkyaetliysalldakasefgarm
tamgnatdnatemletltlqfnrarqaaitqeiaeivaganalr

SCOPe Domain Coordinates for d5hkko_:

Click to download the PDB-style file with coordinates for d5hkko_.
(The format of our PDB-style files is described here.)

Timeline for d5hkko_: