Class a: All alpha proteins [46456] (290 folds) |
Fold a.69: Left-handed superhelix [47916] (4 superfamilies) core: 4-5 helices; bundle; left-handed superhelix |
Superfamily a.69.1: C-terminal domain of alpha and beta (or A/B) subunits of rotary ATPases [47917] (4 families) |
Family a.69.1.0: automated matches [254233] (1 protein) not a true family |
Protein automated matches [254528] (17 species) not a true protein |
Species Caldalkalibacillus thermarum [TaxId:986075] [322897] (2 PDB entries) |
Domain d5hkkk3: 5hkk K:372-502 [322934] Other proteins in same PDB: d5hkka1, d5hkka2, d5hkkb1, d5hkkb2, d5hkkc1, d5hkkc2, d5hkkd1, d5hkkd2, d5hkke1, d5hkke2, d5hkkf1, d5hkkf2, d5hkkg_, d5hkki1, d5hkki2, d5hkkj1, d5hkkj2, d5hkkk1, d5hkkk2, d5hkkl1, d5hkkl2, d5hkkm1, d5hkkm2, d5hkkn1, d5hkkn2, d5hkko_ automated match to d1maba1 complexed with adp, atp, gol, mg, po4 |
PDB Entry: 5hkk (more details), 3 Å
SCOPe Domain Sequences for d5hkkk3:
Sequence; same for both SEQRES and ATOM records: (download)
>d5hkkk3 a.69.1.0 (K:372-502) automated matches {Caldalkalibacillus thermarum [TaxId: 986075]} ikamkkvagtlrldlaqyrelqafaqfgsdldkatqaklnrgertveilkqdehkpmpve eqvisiyavtngfmddipvedvrrfeeellsfmrankdslldhirqtgelpdtkeldaai eefkkgftpsa
Timeline for d5hkkk3:
View in 3D Domains from other chains: (mouse over for more information) d5hkka1, d5hkka2, d5hkka3, d5hkkb1, d5hkkb2, d5hkkb3, d5hkkc1, d5hkkc2, d5hkkc3, d5hkkd1, d5hkkd2, d5hkkd3, d5hkke1, d5hkke2, d5hkke3, d5hkkf1, d5hkkf2, d5hkkf3, d5hkkg_, d5hkki1, d5hkki2, d5hkki3, d5hkkj1, d5hkkj2, d5hkkj3, d5hkkl1, d5hkkl2, d5hkkl3, d5hkkm1, d5hkkm2, d5hkkm3, d5hkkn1, d5hkkn2, d5hkkn3, d5hkko_ |