Lineage for d1e0jc_ (1e0j C:)

  1. Root: SCOP 1.65
  2. 305035Class c: Alpha and beta proteins (a/b) [51349] (121 folds)
  3. 313180Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 313181Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (21 families) (S)
    division into families based on beta-sheet topologies
  5. 314141Family c.37.1.11: RecA protein-like (ATPase-domain) [52670] (11 proteins)
    core: mixed beta-sheet of 8 strands, order 32451678; strand 7 is antiparallel to the rest
  6. 314275Protein Gene 4 protein (g4p, DNA primase), helicase domain [52674] (1 species)
  7. 314276Species Bacteriophage T7 [TaxId:10760] [52675] (6 PDB entries)
  8. 314283Domain d1e0jc_: 1e0j C: [32292]

Details for d1e0jc_

PDB Entry: 1e0j (more details), 3 Å

PDB Description: gp4d helicase from phage t7 adpnp complex

SCOP Domain Sequences for d1e0jc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e0jc_ c.37.1.11 (C:) Gene 4 protein (g4p, DNA primase), helicase domain {Bacteriophage T7}
pdgvvsalslrerirehlsseesvgllfsgctgindktlgarggevimvtsgsgmgkstf
vrqqalqwgtamgkkvglamleesveetaedliglhnrvrlrqsdslkreiiengkfdqw
fdelfgndtfhlydsfaeaetdrllaklaymrsglgcdviildhisivvsasgesderkm
idnlmtklkgfakstgvvlvvichlknpdkgkaheegrpvsitdlrgsgalrqlsdtiia
lernqqgdmpnlvlvrilkcrftgdtgiagymeynketgwlepssysg

SCOP Domain Coordinates for d1e0jc_:

Click to download the PDB-style file with coordinates for d1e0jc_.
(The format of our PDB-style files is described here.)

Timeline for d1e0jc_: