![]() | Class c: Alpha and beta proteins (a/b) [51349] (97 folds) |
![]() | Fold c.37: P-loop containing nucleotide triphosphate hydrolases [52539] (1 superfamily) |
![]() | Superfamily c.37.1: P-loop containing nucleotide triphosphate hydrolases [52540] (14 families) ![]() |
![]() | Protein Gene 4 protein (g4p, DNA primase), helicase domain [52674] (1 species) |
![]() | Species Bacteriophage T7 [TaxId:10760] [52675] (6 PDB entries) |
![]() | Domain d1e0jc_: 1e0j C: [32292] |
PDB Entry: 1e0j (more details), 3 Å
SCOP Domain Sequences for d1e0jc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1e0jc_ c.37.1.11 (C:) Gene 4 protein (g4p, DNA primase), helicase domain {Bacteriophage T7} pdgvvsalslrerirehlsseesvgllfsgctgindktlgarggevimvtsgsgmgkstf vrqqalqwgtamgkkvglamleesveetaedliglhnrvrlrqsdslkreiiengkfdqw fdelfgndtfhlydsfaeaetdrllaklaymrsglgcdviildhisivvsasgesderkm idnlmtklkgfakstgvvlvvichlknpdkgkaheegrpvsitdlrgsgalrqlsdtiia lernqqgdmpnlvlvrilkcrftgdtgiagymeynketgwlepssysg
Timeline for d1e0jc_: