![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
![]() | Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) ![]() division into families based on beta-sheet topologies |
![]() | Family c.37.1.11: RecA protein-like (ATPase-domain) [52670] (22 proteins) core: mixed beta-sheet of 8 strands, order 32451678; strand 7 is antiparallel to the rest |
![]() | Protein Gene 4 protein (g4p, DNA primase), helicase domain [52674] (1 species) |
![]() | Species Bacteriophage T7 [TaxId:10760] [52675] (7 PDB entries) |
![]() | Domain d1e0jc_: 1e0j C: [32292] protein/DNA complex; complexed with anp, mg |
PDB Entry: 1e0j (more details), 3 Å
SCOPe Domain Sequences for d1e0jc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1e0jc_ c.37.1.11 (C:) Gene 4 protein (g4p, DNA primase), helicase domain {Bacteriophage T7 [TaxId: 10760]} pdgvvsalslrerirehlsseesvgllfsgctgindktlgarggevimvtsgsgmgkstf vrqqalqwgtamgkkvglamleesveetaedliglhnrvrlrqsdslkreiiengkfdqw fdelfgndtfhlydsfaeaetdrllaklaymrsglgcdviildhisivvsasgesderkm idnlmtklkgfakstgvvlvvichlknpdkgkaheegrpvsitdlrgsgalrqlsdtiia lernqqgdmpnlvlvrilkcrftgdtgiagymeynketgwlepssysg
Timeline for d1e0jc_: