SCOPe 2.08: Domain d5hkkb3: 5hkk B:372-501

Lineage for d5hkkb3 (5hkk B:372-501)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.69: Left-handed superhelix [47916] (4 superfamilies)
   core: 4-5 helices; bundle; left-handed superhelix

4. Superfamily a.69.1: C-terminal domain of alpha and beta (or A/B) subunits of rotary ATPases [47917] (4 families)

5. Family a.69.1.0: automated matches [254233] (1 protein)
   not a true family

6. Protein automated matches [254528] (17 species)
   not a true protein

7. Species Caldalkalibacillus thermarum [TaxId:986075] [322897] (2 PDB entries)

8. Domain d5hkkb3: 5hkk B:372-501 [322919]
   Other proteins in same PDB: d5hkka1, d5hkka2, d5hkkb1, d5hkkb2, d5hkkc1, d5hkkc2, d5hkkd1, d5hkkd2, d5hkke1, d5hkke2, d5hkkf1, d5hkkf2, d5hkkg_, d5hkki1, d5hkki2, d5hkkj1, d5hkkj2, d5hkkk1, d5hkkk2, d5hkkl1, d5hkkl2, d5hkkm1, d5hkkm2, d5hkkn1, d5hkkn2, d5hkko_
   automated match to d1maba1
   complexed with adp, atp, gol, mg, po4

Details for d5hkkb3

PDB Entry: 5hkk, 3 Å

PDB Description: caldalaklibacillus thermarum f1-atpase (wild type)

PDB Compounds: (B:) ATP synthase subunit alpha

SCOPe Domain Sequences for d5hkkb3:

Sequence; same for both SEQRES and ATOM records:

>d5hkkb3 a.69.1.0 (B:372-501) automated matches {Caldalkalibacillus thermarum [TaxId: 986075]}
ikamkkvagtlrldlaqyrelqafaqfgsdldkatqaklnrgertveilkqdehkpmpve
eqvisiyavtngfmddipvedvrrfeeellsfmrankdslldhirqtgelpdtkeldaai
eefkkgftps

Timeline for d5hkkb3:

• d5hkkb3 first appeared in SCOPe 2.06
  
• d5hkkb3 appears in SCOPe 2.07