SCOP 1.69: Domain d1e0jb_: 1e0j B:

Lineage for d1e0jb_ (1e0j B:)

1. Root: SCOP 1.69

2. Class c: Alpha and beta proteins (a/b) [51349] (136 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (22 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.11: RecA protein-like (ATPase-domain) [52670] (14 proteins)
   core: mixed beta-sheet of 8 strands, order 32451678; strand 7 is antiparallel to the rest

6. Protein Gene 4 protein (g4p, DNA primase), helicase domain [52674] (1 species)

7. Species Bacteriophage T7 [TaxId:10760] [52675] (7 PDB entries)

8. Domain d1e0jb_: 1e0j B: [32291]

Details for d1e0jb_

PDB Entry: 1e0j, 3 Å

PDB Description: gp4d helicase from phage t7 adpnp complex

SCOP Domain Sequences for d1e0jb_:

Sequence; same for both SEQRES and ATOM records:

>d1e0jb_ c.37.1.11 (B:) Gene 4 protein (g4p, DNA primase), helicase domain {Bacteriophage T7}
pdgvvsalslrerirehlsseesvgllfsgctgindktlgarggevimvtsgsgmgkstf
vrqqalqwgtamgkkvglamleesveetaedliglhnrvrlrqsdslkreiiengkfdqw
fdelfgndtfhlydsfaeaetdrllaklaymrsglgcdviildhisivvsasgesderkm
idnlmtklkgfakstgvvlvvichlknpdkgkaheegrpvsitdlrgsgalrqlsdtiia
lernqqgdmpnlvlvrilkcrftgdtgiagymeynketgwlepssysg

Timeline for d1e0jb_:

• d1e0jb_ first appeared (with stable ids) in SCOP 1.55
  
• d1e0jb_ appears in SCOP 1.67
  
• d1e0jb_ appears in SCOP 1.71
  
• d1e0jb_ appears in the current release, SCOPe 2.08