Lineage for d5hkkl1 (5hkk L:2-76)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2067173Fold b.49: Domain of alpha and beta subunits of F1 ATP synthase-like [50614] (3 superfamilies)
    barrel, closed; n=6, S=8; greek-key
  4. 2067174Superfamily b.49.1: N-terminal domain of alpha and beta (or A/B) subunits of rotary ATPases [50615] (3 families) (S)
    automatically mapped to Pfam PF02874
  5. 2067393Family b.49.1.0: automated matches [254232] (1 protein)
    not a true family
  6. 2067394Protein automated matches [254527] (11 species)
    not a true protein
  7. 2067404Species Caldalkalibacillus thermarum [TaxId:986075] [322893] (2 PDB entries)
  8. 2067426Domain d5hkkl1: 5hkk L:2-76 [322909]
    Other proteins in same PDB: d5hkka2, d5hkka3, d5hkkb2, d5hkkb3, d5hkkc2, d5hkkc3, d5hkkd2, d5hkkd3, d5hkke2, d5hkke3, d5hkkf2, d5hkkf3, d5hkkg_, d5hkki2, d5hkki3, d5hkkj2, d5hkkj3, d5hkkk2, d5hkkk3, d5hkkl2, d5hkkl3, d5hkkm2, d5hkkm3, d5hkkn2, d5hkkn3, d5hkko_
    automated match to d2qe7d1
    complexed with adp, atp, gol, mg, po4

Details for d5hkkl1

PDB Entry: 5hkk (more details), 3 Å

PDB Description: caldalaklibacillus thermarum f1-atpase (wild type)
PDB Compounds: (L:) ATP synthase subunit beta

SCOPe Domain Sequences for d5hkkl1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5hkkl1 b.49.1.0 (L:2-76) automated matches {Caldalkalibacillus thermarum [TaxId: 986075]}
nkgriiqvmgpvvdiqfesgqlpdiynaitierpqggtltveaavhlgdnvvrcvamast
dglvrgleavdtgap

SCOPe Domain Coordinates for d5hkkl1:

Click to download the PDB-style file with coordinates for d5hkkl1.
(The format of our PDB-style files is described here.)

Timeline for d5hkkl1: