Class b: All beta proteins [48724] (180 folds) |
Fold b.49: Domain of alpha and beta subunits of F1 ATP synthase-like [50614] (4 superfamilies) barrel, closed; n=6, S=8; greek-key Many cradle-loop superfamilies may be homologous, according to PubMed 18457946 |
Superfamily b.49.1: N-terminal domain of alpha and beta (or A/B) subunits of rotary ATPases [50615] (3 families) automatically mapped to Pfam PF02874 |
Family b.49.1.0: automated matches [254232] (1 protein) not a true family |
Protein automated matches [254527] (17 species) not a true protein |
Species Caldalkalibacillus thermarum [TaxId:986075] [322893] (2 PDB entries) |
Domain d5hkkl1: 5hkk L:2-76 [322909] Other proteins in same PDB: d5hkka2, d5hkka3, d5hkkb2, d5hkkb3, d5hkkc2, d5hkkc3, d5hkkd2, d5hkkd3, d5hkke2, d5hkke3, d5hkkf2, d5hkkf3, d5hkkg_, d5hkki2, d5hkki3, d5hkkj2, d5hkkj3, d5hkkk2, d5hkkk3, d5hkkl2, d5hkkl3, d5hkkm2, d5hkkm3, d5hkkn2, d5hkkn3, d5hkko_ automated match to d2qe7d1 complexed with adp, atp, gol, mg, po4 |
PDB Entry: 5hkk (more details), 3 Å
SCOPe Domain Sequences for d5hkkl1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5hkkl1 b.49.1.0 (L:2-76) automated matches {Caldalkalibacillus thermarum [TaxId: 986075]} nkgriiqvmgpvvdiqfesgqlpdiynaitierpqggtltveaavhlgdnvvrcvamast dglvrgleavdtgap
Timeline for d5hkkl1:
View in 3D Domains from other chains: (mouse over for more information) d5hkka1, d5hkka2, d5hkka3, d5hkkb1, d5hkkb2, d5hkkb3, d5hkkc1, d5hkkc2, d5hkkc3, d5hkkd1, d5hkkd2, d5hkkd3, d5hkke1, d5hkke2, d5hkke3, d5hkkf1, d5hkkf2, d5hkkf3, d5hkkg_, d5hkki1, d5hkki2, d5hkki3, d5hkkj1, d5hkkj2, d5hkkj3, d5hkkk1, d5hkkk2, d5hkkk3, d5hkkm1, d5hkkm2, d5hkkm3, d5hkkn1, d5hkkn2, d5hkkn3, d5hkko_ |