Lineage for d5hkki2 (5hkk I:95-371)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2123292Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2123293Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2128217Family c.37.1.0: automated matches [191323] (1 protein)
    not a true family
  6. 2128218Protein automated matches [190123] (130 species)
    not a true protein
  7. 2128367Species Caldalkalibacillus thermarum [TaxId:986075] [322895] (1 PDB entry)
  8. 2128371Domain d5hkki2: 5hkk I:95-371 [322904]
    Other proteins in same PDB: d5hkka1, d5hkka3, d5hkkb1, d5hkkb3, d5hkkc1, d5hkkc3, d5hkkd1, d5hkkd2, d5hkkd3, d5hkke1, d5hkke2, d5hkke3, d5hkkf1, d5hkkf2, d5hkkf3, d5hkkg_, d5hkki1, d5hkki3, d5hkkj1, d5hkkj3, d5hkkk1, d5hkkk3, d5hkkl1, d5hkkl2, d5hkkl3, d5hkkm1, d5hkkm2, d5hkkm3, d5hkkn1, d5hkkn2, d5hkkn3, d5hkko_
    automated match to d1maba3
    complexed with adp, atp, gol, mg, po4

Details for d5hkki2

PDB Entry: 5hkk (more details), 3 Å

PDB Description: caldalaklibacillus thermarum f1-atpase (wild type)
PDB Compounds: (I:) ATP synthase subunit alpha

SCOPe Domain Sequences for d5hkki2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5hkki2 c.37.1.0 (I:95-371) automated matches {Caldalkalibacillus thermarum [TaxId: 986075]}
mevpvgeallgrvvnplgqpldgrgpietaeyrpiespapgvmdrksvheplqtgikaid
smipigrgqreliigdrqtgkttiaidtiinqkgqdviciyvaigqkqstvagvvetlrq
hdaldytivvtasasepapllylapyagcamgeyfmykgkhalvvyddlskqaaayrels
lllrrppgreaypgdvfylhsrlleraaklsdekgggsltalpfietqagdvsayiptnv
isitdgqiflesdlfysgvrpavnvgisvsrvggaaq

SCOPe Domain Coordinates for d5hkki2:

Click to download the PDB-style file with coordinates for d5hkki2.
(The format of our PDB-style files is described here.)

Timeline for d5hkki2: