![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.92: Chelatase-like [53799] (3 superfamilies) duplication: tandem repeat of two domains; 3 layers (a/b/a); parallel beta-sheet of 4 strands, order 2134 |
![]() | Superfamily c.92.2: 'Helical backbone' metal receptor [53807] (5 families) ![]() contains a long alpha helical insertion in the interdomain linker |
![]() | Family c.92.2.0: automated matches [191548] (1 protein) not a true family |
![]() | Protein automated matches [190944] (40 species) not a true protein |
![]() | Species Staphylococcus aureus [TaxId:1280] [267935] (3 PDB entries) |
![]() | Domain d5hdqa_: 5hdq A: [322899] Other proteins in same PDB: d5hdqh1, d5hdqh2, d5hdql1, d5hdql2 automated match to d4k3va_ complexed with fe, gol |
PDB Entry: 5hdq (more details), 1.83 Å
SCOPe Domain Sequences for d5hdqa_:
Sequence, based on SEQRES records: (download)
>d5hdqa_ c.92.2.0 (A:) automated matches {Staphylococcus aureus [TaxId: 1280]} lkvvttnsilydmaknvggdnvdihsivpvgqdpheyevkpkdikkltdadvilynglnl etgngwfekaleqagkslkdkkviavskdvkpiylngeegnkdkqdphawlsldngikyv ktiqqtfidndkkhkadyekqgnkyiaqleklnndskdkfndipkeqramitsegafkyf skqygitpgyiweintekqgtpeqmrqaiefvkkhklkhllvetsvdkkameslseetkk difgevytdsigkegtkgdsyykmmksnietvhgsmk
>d5hdqa_ c.92.2.0 (A:) automated matches {Staphylococcus aureus [TaxId: 1280]} lkvvttnsilydmaknvggdnvdihsivpvgqdpheyevkpkdikkltdadvilynglnl etgngwfekaleqagkslkdkkviavskdvkpiylngedkqdphawlsldngikyvktiq qtfidndkkhkadyekqgnkyiaqleklnndskdkfndipkeqramitsegafkyfskqy gitpgyiweintekqgtpeqmrqaiefvkkhklkhllvetsvdkkameslseetkkdifg evytdsigkegtkgdsyykmmksnietvhgsmk
Timeline for d5hdqa_:
![]() Domains from other chains: (mouse over for more information) d5hdqh1, d5hdqh2, d5hdql1, d5hdql2 |