Lineage for d1cr1a_ (1cr1 A:)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 69448Fold c.37: P-loop containing nucleotide triphosphate hydrolases [52539] (1 superfamily)
  4. 69449Superfamily c.37.1: P-loop containing nucleotide triphosphate hydrolases [52540] (15 families) (S)
  5. 70095Family c.37.1.11: RecA protein-like (ATPase-domain) [52670] (6 proteins)
  6. 70175Protein Gene 4 protein (g4p, DNA primase), helicase domain [52674] (1 species)
  7. 70176Species Bacteriophage T7 [TaxId:10760] [52675] (6 PDB entries)
  8. 70177Domain d1cr1a_: 1cr1 A: [32286]

Details for d1cr1a_

PDB Entry: 1cr1 (more details), 2.3 Å

PDB Description: crystal structure of the helicase domain of the gene 4 protein of bacteriophage t7: complex with dttp

SCOP Domain Sequences for d1cr1a_:

Sequence, based on SEQRES records: (download)

>d1cr1a_ c.37.1.11 (A:) Gene 4 protein (g4p, DNA primase), helicase domain {Bacteriophage T7}
mrerirehlsseesvgllfsgctgindktlgarggevimvtsgsgmgkstfvrqqalqwg
tamgkkvglamleesveetaedliglhnrvrlrqsdslkreiiengkfdqwfdelfgndt
fhlydsfaeaetdrllaklaymrsglgcdviildhisivvsasgesderkmidnlmtklk
gfakstgvvlvvichlknpdkgkaheegrpvsitdlrgsgalrqlsdtiialernqqgdm
pnlvlvrilkcrftgdtgiagymeynketgwlepssy

Sequence, based on observed residues (ATOM records): (download)

>d1cr1a_ c.37.1.11 (A:) Gene 4 protein (g4p, DNA primase), helicase domain {Bacteriophage T7}
mrerirehlsseesvgllfsgctgindktlgarggevimvtsgsgmgkstfvrqqalqwg
tamgkkvglamleesveetaedliglhnrvrlrqsdslkreiiengkfdqwfdelfgndt
fhlydsfaeaetdrllaklaymrsglgcdviildhisirkmidnlmtklkgfakstgvvl
vvichlktdlrgsgalrqlsdtiialernqlvlvrilkcrftgdtgiagymeynketgwl
epssy

SCOP Domain Coordinates for d1cr1a_:

Click to download the PDB-style file with coordinates for d1cr1a_.
(The format of our PDB-style files is described here.)

Timeline for d1cr1a_: