Lineage for d1cr1a_ (1cr1 A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2109203Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2109204Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2112131Family c.37.1.11: RecA protein-like (ATPase-domain) [52670] (21 protein domains)
    core: mixed beta-sheet of 8 strands, order 32451678; strand 7 is antiparallel to the rest
  6. 2112477Protein Gene 4 protein (g4p, DNA primase), helicase domain [52674] (1 species)
  7. 2112478Species Bacteriophage T7 [TaxId:10760] [52675] (7 PDB entries)
  8. 2112479Domain d1cr1a_: 1cr1 A: [32286]
    complexed with so4, ttp

Details for d1cr1a_

PDB Entry: 1cr1 (more details), 2.3 Å

PDB Description: crystal structure of the helicase domain of the gene 4 protein of bacteriophage t7: complex with dttp
PDB Compounds: (A:) DNA primase/helicase

SCOPe Domain Sequences for d1cr1a_:

Sequence, based on SEQRES records: (download)

>d1cr1a_ c.37.1.11 (A:) Gene 4 protein (g4p, DNA primase), helicase domain {Bacteriophage T7 [TaxId: 10760]}
mrerirehlsseesvgllfsgctgindktlgarggevimvtsgsgmgkstfvrqqalqwg
tamgkkvglamleesveetaedliglhnrvrlrqsdslkreiiengkfdqwfdelfgndt
fhlydsfaeaetdrllaklaymrsglgcdviildhisivvsasgesderkmidnlmtklk
gfakstgvvlvvichlknpdkgkaheegrpvsitdlrgsgalrqlsdtiialernqqgdm
pnlvlvrilkcrftgdtgiagymeynketgwlepssy

Sequence, based on observed residues (ATOM records): (download)

>d1cr1a_ c.37.1.11 (A:) Gene 4 protein (g4p, DNA primase), helicase domain {Bacteriophage T7 [TaxId: 10760]}
mrerirehlsseesvgllfsgctgindktlgarggevimvtsgsgmgkstfvrqqalqwg
tamgkkvglamleesveetaedliglhnrvrlrqsdslkreiiengkfdqwfdelfgndt
fhlydsfaeaetdrllaklaymrsglgcdviildhisirkmidnlmtklkgfakstgvvl
vvichlktdlrgsgalrqlsdtiialernqlvlvrilkcrftgdtgiagymeynketgwl
epssy

SCOPe Domain Coordinates for d1cr1a_:

Click to download the PDB-style file with coordinates for d1cr1a_.
(The format of our PDB-style files is described here.)

Timeline for d1cr1a_: