Lineage for d5b1av_ (5b1a V:)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3024792Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
    not a true fold
    annotated by the SCOP(e) curators as 'not a true fold'
  4. 3025021Superfamily f.23.3: Mitochondrial cytochrome c oxidase subunit VIc [81415] (1 family) (S)
    automatically mapped to Pfam PF02937
  5. 3025022Family f.23.3.1: Mitochondrial cytochrome c oxidase subunit VIc [81414] (1 protein)
  6. 3025023Protein Mitochondrial cytochrome c oxidase subunit VIc [81413] (1 species)
    function unknown, probably acts as a regulator or is required for the assembly
  7. 3025024Species Cow (Bos taurus) [TaxId:9913] [81412] (57 PDB entries)
  8. 3025034Domain d5b1av_: 5b1a V: [322840]
    Other proteins in same PDB: d5b1aa_, d5b1ab1, d5b1ab2, d5b1ac_, d5b1ad_, d5b1ae_, d5b1af_, d5b1ag_, d5b1ah_, d5b1aj_, d5b1ak_, d5b1al_, d5b1am_, d5b1an_, d5b1ao1, d5b1ao2, d5b1ap_, d5b1aq_, d5b1ar_, d5b1as_, d5b1at_, d5b1au_, d5b1aw_, d5b1ax_, d5b1ay_, d5b1az_
    automated match to d1v54i_
    complexed with cdl, chd, cu, cua, dmu, hea, mg, na, pek, per, pgv, psc, tgl, unx, zn

Details for d5b1av_

PDB Entry: 5b1a (more details), 1.5 Å

PDB Description: bovine heart cytochrome c oxidase in the fully oxidized state at 1.5 angstrom resolution
PDB Compounds: (V:) Cytochrome c oxidase subunit 6C

SCOPe Domain Sequences for d5b1av_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5b1av_ f.23.3.1 (V:) Mitochondrial cytochrome c oxidase subunit VIc {Cow (Bos taurus) [TaxId: 9913]}
stalakpqmrgllarrlrfhivgafmvslgfatfykfavaekrkkayadfyrnydsmkdf
eemrkagifqsak

SCOPe Domain Coordinates for d5b1av_:

Click to download the PDB-style file with coordinates for d5b1av_.
(The format of our PDB-style files is described here.)

Timeline for d5b1av_: