| Class b: All beta proteins [48724] (180 folds) |
| Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) sandwich; 12-14 strands in 2 sheets; complex topology |
Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) ![]() |
| Family b.29.1.0: automated matches [191363] (1 protein) not a true family |
| Protein automated matches [190437] (70 species) not a true protein |
| Species Wisteria floribunda [TaxId:3922] [322647] (4 PDB entries) |
| Domain d5kxda_: 5kxd A: [322837] automated match to d4u36a_ complexed with 6y2, act, ca, mn, nag |
PDB Entry: 5kxd (more details), 1.95 Å
SCOPe Domain Sequences for d5kxda_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5kxda_ b.29.1.0 (A:) automated matches {Wisteria floribunda [TaxId: 3922]}
kettsfvftrfspdpqnlllqgdtvvtssghlqltqvkdgepvysslgralyyapihiwd
sntdtvanfvtsfsfvidapnkakaadglafflapvdtepqkpggllglfhddrhnksnh
ivavefdtfknswdpegthiginvnsivsrktiswdlennevanvvisyqastktltasl
vypssstsyilndvvdlkqilpeyvrvgftaasglskdhvethdvlawtfdsdlpdps
Timeline for d5kxda_: