Lineage for d5lmbb_ (5lmb B:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2542179Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2542180Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2542316Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 2545010Protein Tyrosine-protein kinase SYK [118131] (1 species)
    PTK group; SYK/ZAP-70 subfamily; non-membrane spanning protein tyrosine kinase
  7. 2545011Species Human (Homo sapiens) [TaxId:9606] [118132] (64 PDB entries)
    Uniprot P43405 363-635 # structure of the SH2 domain tandem region (9-265) is also known (55576)
  8. 2545049Domain d5lmbb_: 5lmb B: [322835]
    automated match to d3tuca_
    complexed with 6zf, gol

Details for d5lmbb_

PDB Entry: 5lmb (more details), 1.95 Å

PDB Description: human spleen tyrosine kinase kinase domain in complex with azanaphthyridine inhibitor
PDB Compounds: (B:) Tyrosine-protein kinase SYK

SCOPe Domain Sequences for d5lmbb_:

Sequence, based on SEQRES records: (download)

>d5lmbb_ d.144.1.7 (B:) Tyrosine-protein kinase SYK {Human (Homo sapiens) [TaxId: 9606]}
yldrklltledkelgsgnfgtvkkgyyqmkkvvktvavkilkneandpalkdellaeanv
mqqldnpyivrmigiceaeswmlvmemaelgplnkylqqnrhvkdkniielvhqvsmgmk
yleesnfvhrdlaarnvllvtqhyakisdfglskalradenyykaqthgkwpvkwyapec
inyykfssksdvwsfgvlmweafsygqkpyrgmkgsevtamlekgermgcpagcpremyd
lmnlcwtydvenrpgfaavelrlrnyy

Sequence, based on observed residues (ATOM records): (download)

>d5lmbb_ d.144.1.7 (B:) Tyrosine-protein kinase SYK {Human (Homo sapiens) [TaxId: 9606]}
yldrklltledkelgsgnfgtvkkgyyqmkkvvktvavkilkneandpalkdellaeanv
mqqldnpyivrmigiceaeswmlvmemaelgplnkylqqnrhvkdkniielvhqvsmgmk
yleesnfvhrdlaarnvllvtqhyakisdfglskalradenyykawpvkwyapecinyyk
fssksdvwsfgvlmweafsygqkpyrgmkgsevtamlekgermgcpagcpremydlmnlc
wtydvenrpgfaavelrlrnyy

SCOPe Domain Coordinates for d5lmbb_:

Click to download the PDB-style file with coordinates for d5lmbb_.
(The format of our PDB-style files is described here.)

Timeline for d5lmbb_: