Lineage for d1rea_1 (1rea 3-268)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 483669Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 483670Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (22 families) (S)
    division into families based on beta-sheet topologies
  5. 484903Family c.37.1.11: RecA protein-like (ATPase-domain) [52670] (14 proteins)
    core: mixed beta-sheet of 8 strands, order 32451678; strand 7 is antiparallel to the rest
  6. 485146Protein RecA protein, ATPase-domain [52671] (3 species)
    C-terminal domain is alpha+beta
  7. 485147Species Escherichia coli [TaxId:562] [52672] (5 PDB entries)
  8. 485152Domain d1rea_1: 1rea 3-268 [32283]
    Other proteins in same PDB: d1rea_2

Details for d1rea_1

PDB Entry: 1rea (more details), 2.7 Å

PDB Description: structure of the reca protein-adp complex
PDB Compounds: ( :)

SCOP Domain Sequences for d1rea_1:

Sequence, based on SEQRES records: (download)

>d1rea_1 c.37.1.11 (3-268) RecA protein, ATPase-domain {Escherichia coli}
denkqkalaaalgqiekqfgkgsimrlgedrsmdvetistgslsldialgagglpmgriv
eiygpessgkttltlqviaaaqregktcafidaehaldpiyarklgvdidnllcsqpdtg
eqaleicdalarsgavdvivvdsvaaltpkaeiegeigdshmglaarmmsqamrklagnl
kqsntllifinqirmkigvmfgnpetttggnalkfyasvrldirrigavkegenvvgset
rvkvvknkiaapfkqaefqilygegi

Sequence, based on observed residues (ATOM records): (download)

>d1rea_1 c.37.1.11 (3-268) RecA protein, ATPase-domain {Escherichia coli}
denkqkalaaalgqiekqfgkgsimrlgedrsmdvetistgslsldialgagglpmgriv
eiygpessgkttltlqviaaaqregktcafidaehaldpiyarklgvdidnllcsqpdtg
eqaleicdalarsgavdvivvdsvaaltpkaeieglaarmmsqamrklagnlkqsntlli
finqitggnalkfyasvrldirrigavkegenvvgsetrvkvvknkiaapfkqaefqily
gegi

SCOP Domain Coordinates for d1rea_1:

Click to download the PDB-style file with coordinates for d1rea_1.
(The format of our PDB-style files is described here.)

Timeline for d1rea_1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1rea_2