Lineage for d1rea_1 (1rea 3-268)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 69448Fold c.37: P-loop containing nucleotide triphosphate hydrolases [52539] (1 superfamily)
  4. 69449Superfamily c.37.1: P-loop containing nucleotide triphosphate hydrolases [52540] (15 families) (S)
  5. 70095Family c.37.1.11: RecA protein-like (ATPase-domain) [52670] (6 proteins)
  6. 70207Protein RecA protein, ATPase-domain [52671] (2 species)
  7. 70208Species Escherichia coli [TaxId:562] [52672] (2 PDB entries)
  8. 70210Domain d1rea_1: 1rea 3-268 [32283]
    Other proteins in same PDB: d1rea_2

Details for d1rea_1

PDB Entry: 1rea (more details), 2.7 Å

PDB Description: structure of the reca protein-adp complex

SCOP Domain Sequences for d1rea_1:

Sequence, based on SEQRES records: (download)

>d1rea_1 c.37.1.11 (3-268) RecA protein, ATPase-domain {Escherichia coli}
denkqkalaaalgqiekqfgkgsimrlgedrsmdvetistgslsldialgagglpmgriv
eiygpessgkttltlqviaaaqregktcafidaehaldpiyarklgvdidnllcsqpdtg
eqaleicdalarsgavdvivvdsvaaltpkaeiegeigdshmglaarmmsqamrklagnl
kqsntllifinqirmkigvmfgnpetttggnalkfyasvrldirrigavkegenvvgset
rvkvvknkiaapfkqaefqilygegi

Sequence, based on observed residues (ATOM records): (download)

>d1rea_1 c.37.1.11 (3-268) RecA protein, ATPase-domain {Escherichia coli}
denkqkalaaalgqiekqfgkgsimrlgedrsmdvetistgslsldialgagglpmgriv
eiygpessgkttltlqviaaaqregktcafidaehaldpiyarklgvdidnllcsqpdtg
eqaleicdalarsgavdvivvdsvaaltpkaeieglaarmmsqamrklagnlkqsntlli
finqitggnalkfyasvrldirrigavkegenvvgsetrvkvvknkiaapfkqaefqily
gegi

SCOP Domain Coordinates for d1rea_1:

Click to download the PDB-style file with coordinates for d1rea_1.
(The format of our PDB-style files is described here.)

Timeline for d1rea_1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1rea_2