Lineage for d1f48a1 (1f48 A:1-296)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 22942Fold c.37: P-loop containing nucleotide triphosphate hydrolases [52539] (1 superfamily)
  4. 22943Superfamily c.37.1: P-loop containing nucleotide triphosphate hydrolases [52540] (14 families) (S)
  5. 23415Family c.37.1.10: Nitrogenase iron protein-like [52652] (7 proteins)
  6. 23449Protein Arsenite-translocating ATPase ArsA [52668] (1 species)
  7. 23450Species Escherichia coli [TaxId:562] [52669] (1 PDB entry)
  8. 23451Domain d1f48a1: 1f48 A:1-296 [32280]

Details for d1f48a1

PDB Entry: 1f48 (more details), 2.3 Å

PDB Description: crystal structure of the escherichia coli arsenite-translocating atpase

SCOP Domain Sequences for d1f48a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1f48a1 c.37.1.10 (A:1-296) Arsenite-translocating ATPase ArsA {Escherichia coli}
mqflqnippylfftgkggvgktsiscatairlaeqgkrvllvstdpasnvgqvfsqtign
tiqaiasvpglsaleidpqaaaqqyrarivdpikgvlpddvvssineqlsgactteiaaf
deftglltdaslltrfdhiifdtaptghtirllqlpgawssfidsnpegasclgpmagle
kqreqyayavealsdpkrtrlvlvarlqkstlqevarthlelaaiglknqylvingvlpk
teaandtlaaaiwereqealanlpadlaglptdtlflqpvnmvgvsalsrllstqp

SCOP Domain Coordinates for d1f48a1:

Click to download the PDB-style file with coordinates for d1f48a1.
(The format of our PDB-style files is described here.)

Timeline for d1f48a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1f48a2