SCOPe 2.08: Domain d1f48a1: 1f48 A:1-296

Lineage for d1f48a1 (1f48 A:1-296)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.10: Nitrogenase iron protein-like [52652] (16 proteins)
   core: parallel beta-sheet of 7 strands; order 3241567

6. Protein Arsenite-translocating ATPase ArsA [52668] (1 species)
   Duplication: consists of two domains of this fold arranged as the NIP subunits in the dimer

7. Species Escherichia coli [TaxId:562] [52669] (4 PDB entries)

8. Domain d1f48a1: 1f48 A:1-296 [32280]
   Other proteins in same PDB: d1f48a3
   complexed with adp, cd, cl, mg, sb, sbo

Details for d1f48a1

PDB Entry: 1f48, 2.3 Å

PDB Description: crystal structure of the escherichia coli arsenite-translocating atpase

PDB Compounds: (A:) arsenite-translocating ATPase

SCOPe Domain Sequences for d1f48a1:

Sequence; same for both SEQRES and ATOM records:

>d1f48a1 c.37.1.10 (A:1-296) Arsenite-translocating ATPase ArsA {Escherichia coli [TaxId: 562]}
mqflqnippylfftgkggvgktsiscatairlaeqgkrvllvstdpasnvgqvfsqtign
tiqaiasvpglsaleidpqaaaqqyrarivdpikgvlpddvvssineqlsgactteiaaf
deftglltdaslltrfdhiifdtaptghtirllqlpgawssfidsnpegasclgpmagle
kqreqyayavealsdpkrtrlvlvarlqkstlqevarthlelaaiglknqylvingvlpk
teaandtlaaaiwereqealanlpadlaglptdtlflqpvnmvgvsalsrllstqp

Timeline for d1f48a1:

• d1f48a1 first appeared (with stable ids) in SCOP 1.55
  
• d1f48a1 appears in SCOPe 2.07