Lineage for d5bn9a2 (5bn9 A:189-382)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2460924Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2460925Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) (S)
    duplication contains two domains of this fold
  5. 2460926Family c.55.1.1: Actin/HSP70 [53068] (8 protein domains)
  6. 2461320Protein automated matches [226905] (13 species)
    not a true protein
  7. 2461376Species Human (Homo sapiens) [TaxId:9606] [225574] (49 PDB entries)
  8. 2461410Domain d5bn9a2: 5bn9 A:189-382 [322797]
    automated match to d1s3xa2
    complexed with adp, cl, epe, na, po4; mutant

Details for d5bn9a2

PDB Entry: 5bn9 (more details), 1.69 Å

PDB Description: crystal structure of adp bound human hsp70 nbd mutant r272k.
PDB Compounds: (A:) heat shock 70 kda protein 1a

SCOPe Domain Sequences for d5bn9a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5bn9a2 c.55.1.1 (A:189-382) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gkgernvlifdlgggtfdvsiltiddgifevkatagdthlggedfdnrlvnhfveefkrk
hkkdisqnkravrrlrtacerakktlssstqasleidslfegidfytsitrarfeelcsd
lfrstlepvekalrdakldkaqihdlvlvggstripkvqkllqdffngrdlnksinpdea
vaygaavqaailmg

SCOPe Domain Coordinates for d5bn9a2:

Click to download the PDB-style file with coordinates for d5bn9a2.
(The format of our PDB-style files is described here.)

Timeline for d5bn9a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d5bn9a1