Lineage for d5ljyh1 (5ljy H:6-113)

  1. Root: SCOPe 2.08
  2. Class b: All beta proteins [48724] (180 folds)
  3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. Protein automated matches [190740] (30 species)
    not a true protein
  7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1747 PDB entries)
  8. Domain d5ljyh1: 5ljy H:6-113 [322788]
    Other proteins in same PDB: d5ljyh2
    automated match to d1mfah1
    complexed with nag, nco

Details for d5ljyh1

PDB Entry: 5ljy (more details), 3 Å

PDB Description: structure of hantavirus envelope glycoprotein gc in complex with scfv a5
PDB Compounds: (H:) scFvA5

SCOPe Domain Sequences for d5ljyh1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ljyh1 b.1.1.0 (H:6-113) automated matches {Human (Homo sapiens) [TaxId: 9606]}
esgpglvkpsetlsltcvvsggsisssnwwswvrqppgkglewigeiyhsgspnynpslk
srvtisvdksknqfslklssvtaadtavyycarqmrqwgqgtlvtvss

SCOPe Domain Coordinates for d5ljyh1 are not available.

Timeline for d5ljyh1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5ljyh2
View in 3D
Domains from other chains:
(mouse over for more information)
d5ljyl_