| Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
| Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (24 families) ![]() division into families based on beta-sheet topologies |
| Family c.37.1.10: Nitrogenase iron protein-like [52652] (15 proteins) core: parallel beta-sheet of 7 strands; order 3241567 |
| Protein GTPase domain of the signal sequence recognition protein Ffh [52664] (3 species) |
| Species Thermus aquaticus [TaxId:271] [52665] (18 PDB entries) |
| Domain d2ffhc3: 2ffh C:89-307 [32278] Other proteins in same PDB: d2ffha1, d2ffha2, d2ffhb1, d2ffhb2, d2ffhc1, d2ffhc2 complexed with cd, so4; mutant |
PDB Entry: 2ffh (more details), 3.2 Å
SCOP Domain Sequences for d2ffhc3:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ffhc3 c.37.1.10 (C:89-307) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]}
earlpvlkdrnlwflvglqgsgktttaaklalyykgkgrrpllvaadtqrpaareqlrll
gekvgvpvlevmdgespesirrrveekarleardlilvdtagrlqideplmgelarlkev
lgpdevllvldamtgqealsvarafdekvgvtglvltkldgdarggaalsarhvtgkpiy
fagvsekpeglepfyperlagrilgmgdvaslaekvraa
Timeline for d2ffhc3: