Lineage for d2ffhc3 (2ffh C:89-307)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 695085Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 695086Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (24 families) (S)
    division into families based on beta-sheet topologies
  5. 696576Family c.37.1.10: Nitrogenase iron protein-like [52652] (13 proteins)
    core: parallel beta-sheet of 7 strands; order 3241567
  6. 696707Protein GTPase domain of the signal sequence recognition protein Ffh [52664] (3 species)
  7. 696718Species Thermus aquaticus [TaxId:271] [52665] (18 PDB entries)
  8. 696747Domain d2ffhc3: 2ffh C:89-307 [32278]
    Other proteins in same PDB: d2ffha1, d2ffha2, d2ffhb1, d2ffhb2, d2ffhc1, d2ffhc2
    complexed with cd, so4; mutant

Details for d2ffhc3

PDB Entry: 2ffh (more details), 3.2 Å

PDB Description: the signal sequence binding protein ffh from thermus aquaticus
PDB Compounds: (C:) protein (ffh)

SCOP Domain Sequences for d2ffhc3:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ffhc3 c.37.1.10 (C:89-307) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]}
earlpvlkdrnlwflvglqgsgktttaaklalyykgkgrrpllvaadtqrpaareqlrll
gekvgvpvlevmdgespesirrrveekarleardlilvdtagrlqideplmgelarlkev
lgpdevllvldamtgqealsvarafdekvgvtglvltkldgdarggaalsarhvtgkpiy
fagvsekpeglepfyperlagrilgmgdvaslaekvraa

SCOP Domain Coordinates for d2ffhc3:

Click to download the PDB-style file with coordinates for d2ffhc3.
(The format of our PDB-style files is described here.)

Timeline for d2ffhc3: