SCOP 1.57: Domain d2ffhc3: 2ffh C:89-307

Lineage for d2ffhc3 (2ffh C:89-307)

1. Root: SCOP 1.57

2. Class c: Alpha and beta proteins (a/b) [51349] (107 folds)

3. Fold c.37: P-loop containing nucleotide triphosphate hydrolases [52539] (1 superfamily)

4. Superfamily c.37.1: P-loop containing nucleotide triphosphate hydrolases [52540] (15 families)

5. Family c.37.1.10: Nitrogenase iron protein-like [52652] (8 proteins)

6. Protein GTPase domain of the signal sequence recognition protein Ffh [52664] (2 species)

7. Species Thermus aquaticus [TaxId:271] [52665] (5 PDB entries)

8. Domain d2ffhc3: 2ffh C:89-307 [32278]
   Other proteins in same PDB: d2ffha1, d2ffha2, d2ffhb1, d2ffhb2, d2ffhc1, d2ffhc2

Details for d2ffhc3

PDB Entry: 2ffh, 3.2 Å

PDB Description: the signal sequence binding protein ffh from thermus aquaticus

SCOP Domain Sequences for d2ffhc3:

Sequence; same for both SEQRES and ATOM records:

>d2ffhc3 c.37.1.10 (C:89-307) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus}
earlpvlkdrnlwflvglqgsgktttaaklalyykgkgrrpllvaadtqrpaareqlrll
gekvgvpvlevmdgespesirrrveekarleardlilvdtagrlqideplmgelarlkev
lgpdevllvldamtgqealsvarafdekvgvtglvltkldgdarggaalsarhvtgkpiy
fagvsekpeglepfyperlagrilgmgdvaslaekvraa

Timeline for d2ffhc3:

• d2ffhc3 first appeared (with stable ids) in SCOP 1.55
  
• d2ffhc3 appears in SCOP 1.59
  
• d2ffhc3 appears in the current release, SCOPe 2.08