Lineage for d5syxb1 (5syx B:36-443)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2328246Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily)
    multihelical; consists of two all-alpha domains
  4. 2328247Superfamily a.93.1: Heme-dependent peroxidases [48113] (4 families) (S)
  5. 2328762Family a.93.1.3: Catalase-peroxidase KatG [74753] (1 protein)
    duplication: tandem repeat of two CCP-like domains
  6. 2328763Protein Catalase-peroxidase KatG [74754] (6 species)
    only the N-terminal CCP-like domain binds heme
  7. 2328776Species Burkholderia pseudomallei [TaxId:320372] [321159] (45 PDB entries)
  8. 2328835Domain d5syxb1: 5syx B:36-443 [322776]
    automated match to d3n3oa1
    complexed with cl, hem, mpd, na, oxy, po4

Details for d5syxb1

PDB Entry: 5syx (more details), 1.77 Å

PDB Description: crystal structure of burkholderia pseudomallei katg variant w139f
PDB Compounds: (B:) Catalase-peroxidase

SCOPe Domain Sequences for d5syxb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5syxb1 a.93.1.3 (B:36-443) Catalase-peroxidase KatG {Burkholderia pseudomallei [TaxId: 320372]}
gtsnrdwwpnqldlsilhrhsslsdpmgkdfnyaqafekldlaavkrdlhalmttsqdww
padfghygglfirmawhsagtyrtadgrggagegqqrfaplnsfpdnanldkarrllwpi
kqkygraiswadlliltgnvalesmgfktfgfaggradtwepedvywgsekiwlelsggp
nsrysgdrqlenplaavqmgliyvnpegpdgnpdpvaaardirdtfarmamndeetvali
agghtfgkthgagpasnvgaepeaagieaqglgwksayrtgkgadaitsglevtwtttpt
qwshnffenlfgyeweltkspagahqwvakgadavipdafdpskkhrptmlttdlslrfd
payekisrrfhenpeqfadafarawfklthrdmgprarylgpevpaev

SCOPe Domain Coordinates for d5syxb1:

Click to download the PDB-style file with coordinates for d5syxb1.
(The format of our PDB-style files is described here.)

Timeline for d5syxb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5syxb2