Class a: All alpha proteins [46456] (289 folds) |
Fold a.104: Cytochrome P450 [48263] (1 superfamily) multihelical |
Superfamily a.104.1: Cytochrome P450 [48264] (2 families) |
Family a.104.1.0: automated matches [191509] (1 protein) not a true family |
Protein automated matches [190847] (95 species) not a true protein |
Species Streptomyces arenae [TaxId:29301] [322659] (9 PDB entries) |
Domain d5l1oa_: 5l1o A: [322771] automated match to d2xbka_ complexed with 7pf, hem |
PDB Entry: 5l1o (more details), 2.03 Å
SCOPe Domain Sequences for d5l1oa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5l1oa_ a.104.1.0 (A:) automated matches {Streptomyces arenae [TaxId: 29301]} tdlprlpfdnpdimgiapqmlalqkegpiarvgtagedawlvtrydevrtlladrrlrls npnpqpsaksaarafmvalmagddheteparhaqmrslliprfstrrlrlmktriehhvd elldqlaasappvdlhrvlsfrlptmvvcdllgvpladrerfgqwargtfdqsdnehsan tfqqvvdymlelvarkrvepgddilseliaekdgalsdadiahlgnavllfgyettivri dlgtllllrnpvqraqlaedpglapaaveeilrlgvggkgsnalipryahgditvgetvi rtgdavmlaigaanyddrafpdgglfdltrvrprshlafghgarhcigrtlarieltavf erlfrrlpdlrlavpeeslrwqehritggfdeipvtf
Timeline for d5l1oa_: