| Class c: Alpha and beta proteins (a/b) [51349] (97 folds) |
| Fold c.37: P-loop containing nucleotide triphosphate hydrolases [52539] (1 superfamily) |
Superfamily c.37.1: P-loop containing nucleotide triphosphate hydrolases [52540] (14 families) ![]() |
| Family c.37.1.10: Nitrogenase iron protein-like [52652] (7 proteins) |
| Protein GTPase domain of the signal sequence recognition protein Ffh [52664] (1 species) |
| Species Thermus aquaticus [TaxId:271] [52665] (5 PDB entries) |
| Domain d2ffhb3: 2ffh B:89-307 [32277] Other proteins in same PDB: d2ffha1, d2ffha2, d2ffhb1, d2ffhb2, d2ffhc1, d2ffhc2 |
PDB Entry: 2ffh (more details), 3.2 Å
SCOP Domain Sequences for d2ffhb3:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ffhb3 c.37.1.10 (B:89-307) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus}
earlpvlkdrnlwflvglqgsgktttaaklalyykgkgrrpllvaadtqrpaareqlrll
gekvgvpvlevmdgespesirrrveekarleardlilvdtagrlqideplmgelarlkev
lgpdevllvldamtgqealsvarafdekvgvtglvltkldgdarggaalsarhvtgkpiy
fagvsekpeglepfyperlagrilgmgdvaslaekvraa
Timeline for d2ffhb3: