Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
Superfamily c.23.1: CheY-like [52172] (8 families) |
Family c.23.1.0: automated matches [191324] (1 protein) not a true family |
Protein automated matches [190131] (71 species) not a true protein |
Species Burkholderia multivorans [TaxId:87883] [322751] (1 PDB entry) |
Domain d5t3ya_: 5t3y A: [322752] automated match to d3dgec_ |
PDB Entry: 5t3y (more details)
SCOPe Domain Sequences for d5t3ya_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5t3ya_ c.23.1.0 (A:) automated matches {Burkholderia multivorans [TaxId: 87883]} mirtilaiddsatmrallhatlaqagyevtvaadgeagfdlaattaydlvltdqnmprks gleliaalrqlsayadtpilvlttegsdafkaaardagatgwiekpidpgvlvelvatls epaan
Timeline for d5t3ya_: