Lineage for d5t3ya_ (5t3y A:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2438294Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2438295Superfamily c.23.1: CheY-like [52172] (8 families) (S)
  5. 2438674Family c.23.1.0: automated matches [191324] (1 protein)
    not a true family
  6. 2438675Protein automated matches [190131] (73 species)
    not a true protein
  7. 2438752Species Burkholderia multivorans [TaxId:87883] [322751] (1 PDB entry)
  8. 2438753Domain d5t3ya_: 5t3y A: [322752]
    automated match to d3dgec_

Details for d5t3ya_

PDB Entry: 5t3y (more details)

PDB Description: solution structure of response regulator protein from burkholderia multivorans
PDB Compounds: (A:) Two-component system response regulator

SCOPe Domain Sequences for d5t3ya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5t3ya_ c.23.1.0 (A:) automated matches {Burkholderia multivorans [TaxId: 87883]}
mirtilaiddsatmrallhatlaqagyevtvaadgeagfdlaattaydlvltdqnmprks
gleliaalrqlsayadtpilvlttegsdafkaaardagatgwiekpidpgvlvelvatls
epaan

SCOPe Domain Coordinates for d5t3ya_:

Click to download the PDB-style file with coordinates for d5t3ya_.
(The format of our PDB-style files is described here.)

Timeline for d5t3ya_: