Lineage for d3ng1b2 (3ng1 B:89-294)

  1. Root: SCOP 1.65
  2. 305035Class c: Alpha and beta proteins (a/b) [51349] (121 folds)
  3. 313180Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 313181Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (21 families) (S)
    division into families based on beta-sheet topologies
  5. 313972Family c.37.1.10: Nitrogenase iron protein-like [52652] (10 proteins)
    core: parallel beta-sheet of 7 strands; order 3241567
  6. 314068Protein GTPase domain of the signal sequence recognition protein Ffh [52664] (2 species)
  7. 314072Species Thermus aquaticus [TaxId:271] [52665] (8 PDB entries)
  8. 314080Domain d3ng1b2: 3ng1 B:89-294 [32275]
    Other proteins in same PDB: d3ng1a1, d3ng1b1
    complexed with cd, edo, so4

Details for d3ng1b2

PDB Entry: 3ng1 (more details), 2.3 Å

PDB Description: n and gtpase domains of the signal sequence recognition protein ffh from thermus aquaticus

SCOP Domain Sequences for d3ng1b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ng1b2 c.37.1.10 (B:89-294) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus}
earlpvlkdrnlwflvglqgsgktttaaklalyykgkgrrpllvaadtqrpaareqlrll
gekvgvpvlevmdgespesirrrveekarleardlilvdtagrlqideplmgelarlkev
lgpdevllvldamtgqealsvarafdekvgvtglvltkldgdarggaalsarhvtgkpiy
fagvsekpeglepfyperlagrilgm

SCOP Domain Coordinates for d3ng1b2:

Click to download the PDB-style file with coordinates for d3ng1b2.
(The format of our PDB-style files is described here.)

Timeline for d3ng1b2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3ng1b1