SCOP 1.65: Domain d3ng1b2: 3ng1 B:89-294

Lineage for d3ng1b2 (3ng1 B:89-294)

1. Root: SCOP 1.65

2. Class c: Alpha and beta proteins (a/b) [51349] (121 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (21 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.10: Nitrogenase iron protein-like [52652] (10 proteins)
   core: parallel beta-sheet of 7 strands; order 3241567

6. Protein GTPase domain of the signal sequence recognition protein Ffh [52664] (2 species)

7. Species Thermus aquaticus [TaxId:271] [52665] (8 PDB entries)

8. Domain d3ng1b2: 3ng1 B:89-294 [32275]
   Other proteins in same PDB: d3ng1a1, d3ng1b1
   complexed with cd, edo, so4

Details for d3ng1b2

PDB Entry: 3ng1, 2.3 Å

PDB Description: n and gtpase domains of the signal sequence recognition protein ffh from thermus aquaticus

SCOP Domain Sequences for d3ng1b2:

Sequence; same for both SEQRES and ATOM records:

>d3ng1b2 c.37.1.10 (B:89-294) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus}
earlpvlkdrnlwflvglqgsgktttaaklalyykgkgrrpllvaadtqrpaareqlrll
gekvgvpvlevmdgespesirrrveekarleardlilvdtagrlqideplmgelarlkev
lgpdevllvldamtgqealsvarafdekvgvtglvltkldgdarggaalsarhvtgkpiy
fagvsekpeglepfyperlagrilgm

Timeline for d3ng1b2:

• d3ng1b2 first appeared (with stable ids) in SCOP 1.55
  
• d3ng1b2 appears in SCOP 1.63
  
• d3ng1b2 appears in SCOP 1.67
  
• d3ng1b2 appears in the current release, SCOPe 2.08