Lineage for d5l1ra_ (5l1r A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2330957Fold a.104: Cytochrome P450 [48263] (1 superfamily)
    multihelical
  4. 2330958Superfamily a.104.1: Cytochrome P450 [48264] (2 families) (S)
  5. 2331668Family a.104.1.0: automated matches [191509] (1 protein)
    not a true family
  6. 2331669Protein automated matches [190847] (73 species)
    not a true protein
  7. 2332150Species Streptomyces arenae [TaxId:29301] [322659] (9 PDB entries)
  8. 2332151Domain d5l1ra_: 5l1r A: [322739]
    automated match to d2xbka_
    complexed with bcn, hem

Details for d5l1ra_

PDB Entry: 5l1r (more details), 2 Å

PDB Description: x-ray structure of the substrate-free cytochrome p450 pntm
PDB Compounds: (A:) Pentalenolactone synthase

SCOPe Domain Sequences for d5l1ra_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5l1ra_ a.104.1.0 (A:) automated matches {Streptomyces arenae [TaxId: 29301]}
tdlprlpfdnpdimgiapqmlalqkegpiarvgtagedawlvtrydevrtlladrrlrls
npnpqpsaksaarafmvalmagddheteparhaqmrslliprfstrrlrlmktriehhvd
elldqlaasappvdlhrvlsfrlptmvvcdllgvpladrerfgqwargtfdqsdnehsan
tfqqvvdymlelvarkrvepgddilseliaekdgalsdadiahlgnavllfgyettivri
dlgtllllrnpvqraqlaedpglapaaveeilrlgvggkgsnalipryahgditvgetvi
rtgdavmlaigaanyddrafpdgglfdltrvrprshlafghgarhcigrtlarieltavf
erlfrrlpdlrlavpeeslrwqehritggfdeipvtf

SCOPe Domain Coordinates for d5l1ra_:

Click to download the PDB-style file with coordinates for d5l1ra_.
(The format of our PDB-style files is described here.)

Timeline for d5l1ra_: