![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) sandwich; 12-14 strands in 2 sheets; complex topology |
![]() | Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) ![]() |
![]() | Family b.29.1.0: automated matches [191363] (1 protein) not a true family |
![]() | Protein automated matches [190437] (70 species) not a true protein |
![]() | Species Wisteria floribunda [TaxId:3922] [322647] (4 PDB entries) |
![]() | Domain d5kxec_: 5kxe C: [322738] automated match to d4u36a_ complexed with 6y2, ca, mn, po4, so4 |
PDB Entry: 5kxe (more details), 2.09 Å
SCOPe Domain Sequences for d5kxec_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5kxec_ b.29.1.0 (C:) automated matches {Wisteria floribunda [TaxId: 3922]} kettsfvftrfspdpqnlllqgdtvvtssghlqltqvkdgepvysslgralyyapihiwd sntdtvanfvtsfsfvidapnkakaadglafflapvdtepqkpggllglfhddrhnksnh ivavefdtfknswdpegthiginvnsivsrktiswdlendevanvvisyqastktltasl vypssstsyilndvvdlkqilpeyvrvgftaasglskdhvethdvlawtfdsdlpdps
Timeline for d5kxec_: