Lineage for d5t20l_ (5t20 L:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2079278Fold b.78: beta-Prism II [51109] (1 superfamily)
    consists of 3 4-stranded sheets; strands are perpendicular to the 3-fold axis
    duplication: consists of two domains of this fold
  4. 2079279Superfamily b.78.1: alpha-D-mannose-specific plant lectins [51110] (2 families) (S)
  5. 2079331Family b.78.1.0: automated matches [191418] (1 protein)
    not a true family
  6. 2079332Protein automated matches [190587] (7 species)
    not a true protein
  7. 2079333Species Colocasia esculenta [TaxId:4460] [276542] (5 PDB entries)
  8. 2079357Domain d5t20l_: 5t20 L: [322732]
    automated match to d3r0eb_
    complexed with edo, man

Details for d5t20l_

PDB Entry: 5t20 (more details), 1.91 Å

PDB Description: crystal structure of tarin lectin bound to trimannose
PDB Compounds: (L:) lectin

SCOPe Domain Sequences for d5t20l_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5t20l_ b.78.1.0 (L:) automated matches {Colocasia esculenta [TaxId: 4460]}
nipftdnllfsgqvlygdgrltaknhqlvmqgdcnlvlyggkygwqsnthgngehcflrl
nhkgeliikdddfktiwssnssskqgdyvlilrddgfaviygpaiwets

SCOPe Domain Coordinates for d5t20l_:

Click to download the PDB-style file with coordinates for d5t20l_.
(The format of our PDB-style files is described here.)

Timeline for d5t20l_: