Lineage for d5hwbb1 (5hwb B:1-112)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2941336Fold d.26: FKBP-like [54533] (3 superfamilies)
    core: beta(2)-alpha-beta(2); antiparallel beta-sheet
  4. 2941337Superfamily d.26.1: FKBP-like [54534] (4 families) (S)
  5. 2941690Family d.26.1.0: automated matches [191631] (1 protein)
    not a true family
  6. 2941691Protein automated matches [191162] (29 species)
    not a true protein
  7. 2941804Species Neosartorya fumigata [TaxId:330879] [322576] (4 PDB entries)
  8. 2941809Domain d5hwbb1: 5hwb B:1-112 [322730]
    Other proteins in same PDB: d5hwbb2
    automated match to d5b8ic_
    complexed with so4

Details for d5hwbb1

PDB Entry: 5hwb (more details), 2.31 Å

PDB Description: aspergillus fumigatus fkbp12 apo protein in p212121 space group
PDB Compounds: (B:) FK506-binding protein 1A

SCOPe Domain Sequences for d5hwbb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5hwbb1 d.26.1.0 (B:1-112) automated matches {Neosartorya fumigata [TaxId: 330879]}
mgvtkelkspgngvdfpkkgdfvtihytgrltdgskfdssvdrnepfqtqigtgrvikgw
degvpqmslgekavltitpdygygargfppvipgnstlifevellginnkra

SCOPe Domain Coordinates for d5hwbb1:

Click to download the PDB-style file with coordinates for d5hwbb1.
(The format of our PDB-style files is described here.)

Timeline for d5hwbb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5hwbb2
View in 3D
Domains from other chains:
(mouse over for more information)
d5hwba_