SCOPe 2.05: Domain d2ng1a2: 2ng1 A:89-294

Lineage for d2ng1a2 (2ng1 A:89-294)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.10: Nitrogenase iron protein-like [52652] (16 proteins)
   core: parallel beta-sheet of 7 strands; order 3241567

6. Protein GTPase domain of the signal sequence recognition protein Ffh [52664] (3 species)

7. Species Thermus aquaticus [TaxId:271] [52665] (17 PDB entries)

8. Domain d2ng1a2: 2ng1 A:89-294 [32273]
   Other proteins in same PDB: d2ng1a1
   complexed with dio, edo, gdp

Details for d2ng1a2

PDB Entry: 2ng1, 2.02 Å

PDB Description: n and gtpase domains of the signal sequence recognition protein ffh from thermus aquaticus

PDB Compounds: (A:) signal sequence recognition protein ffh

SCOPe Domain Sequences for d2ng1a2:

Sequence; same for both SEQRES and ATOM records:

>d2ng1a2 c.37.1.10 (A:89-294) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]}
earlpvlkdrnlwflvglqgsgktttaaklalyykgkgrrpllvaadtqrpaareqlrll
gekvgvpvlevmdgespesirrrveekarleardlilvdtagrlqideplmgelarlkev
lgpdevllvldamtgqealsvarafdekvgvtglvltkldgdarggaalsarhvtgkpiy
fagvsekpeglepfyperlagrilgm

Timeline for d2ng1a2:

• d2ng1a2 first appeared (with stable ids) in SCOP 1.55, called d2ng1_2
  
• d2ng1a2 appears in SCOPe 2.04
  
• d2ng1a2 appears in SCOPe 2.06
  
• d2ng1a2 appears in the current release, SCOPe 2.08