SCOP 1.63: Domain d2ng1_2: 2ng1 89-294

Lineage for d2ng1_2 (2ng1 89-294)

1. Root: SCOP 1.63

2. Class c: Alpha and beta proteins (a/b) [51349] (117 folds)

3. Fold c.37: P-loop containing nucleotide triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleotide triphosphate hydrolases [52540] (20 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.10: Nitrogenase iron protein-like [52652] (8 proteins)
   core: parallel beta-sheet of 7 strands; order 3241567

6. Protein GTPase domain of the signal sequence recognition protein Ffh [52664] (2 species)

7. Species Thermus aquaticus [TaxId:271] [52665] (8 PDB entries)

8. Domain d2ng1_2: 2ng1 89-294 [32273]
   Other proteins in same PDB: d2ng1_1
   complexed with dox, edo, gdp; mutant

Details for d2ng1_2

PDB Entry: 2ng1, 2.02 Å

PDB Description: n and gtpase domains of the signal sequence recognition protein ffh from thermus aquaticus

SCOP Domain Sequences for d2ng1_2:

Sequence; same for both SEQRES and ATOM records:

>d2ng1_2 c.37.1.10 (89-294) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus}
earlpvlkdrnlwflvglqgsgktttaaklalyykgkgrrpllvaadtqrpaareqlrll
gekvgvpvlevmdgespesirrrveekarleardlilvdtagrlqideplmgelarlkev
lgpdevllvldamtgqealsvarafdekvgvtglvltkldgdarggaalsarhvtgkpiy
fagvsekpeglepfyperlagrilgm

Timeline for d2ng1_2:

• d2ng1_2 first appeared (with stable ids) in SCOP 1.55
  
• d2ng1_2 appears in SCOP 1.61
  
• d2ng1_2 appears in SCOP 1.65
  
• d2ng1_2 appears in the current release, SCOPe 2.08, called d2ng1a2