Lineage for d2ng1a2 (2ng1 A:89-294)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2865683Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2865684Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. 2869013Family c.37.1.10: Nitrogenase iron protein-like [52652] (16 proteins)
    core: parallel beta-sheet of 7 strands; order 3241567
  6. 2869152Protein GTPase domain of the signal sequence recognition protein Ffh [52664] (3 species)
  7. 2869164Species Thermus aquaticus [TaxId:271] [52665] (16 PDB entries)
  8. 2869188Domain d2ng1a2: 2ng1 A:89-294 [32273]
    Other proteins in same PDB: d2ng1a1
    complexed with dio, edo, gdp

Details for d2ng1a2

PDB Entry: 2ng1 (more details), 2.02 Å

PDB Description: n and gtpase domains of the signal sequence recognition protein ffh from thermus aquaticus
PDB Compounds: (A:) signal sequence recognition protein ffh

SCOPe Domain Sequences for d2ng1a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ng1a2 c.37.1.10 (A:89-294) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]}
earlpvlkdrnlwflvglqgsgktttaaklalyykgkgrrpllvaadtqrpaareqlrll
gekvgvpvlevmdgespesirrrveekarleardlilvdtagrlqideplmgelarlkev
lgpdevllvldamtgqealsvarafdekvgvtglvltkldgdarggaalsarhvtgkpiy
fagvsekpeglepfyperlagrilgm

SCOPe Domain Coordinates for d2ng1a2:

Click to download the PDB-style file with coordinates for d2ng1a2.
(The format of our PDB-style files is described here.)

Timeline for d2ng1a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2ng1a1