Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) duplication contains two domains of this fold |
Family c.55.1.1: Actin/HSP70 [53068] (8 proteins) |
Protein automated matches [226905] (13 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [225574] (54 PDB entries) |
Domain d5bpma2: 5bpm A:189-381 [322729] automated match to d1s3xa2 complexed with atp, cl, mg, na; mutant |
PDB Entry: 5bpm (more details), 1.83 Å
SCOPe Domain Sequences for d5bpma2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5bpma2 c.55.1.1 (A:189-381) automated matches {Human (Homo sapiens) [TaxId: 9606]} gkgernvlifdlgggtfdvsiltiddgifevkatagdthlggedfdnrlvnhfveefkrk hkkdisqnkravrrlrtacqrakktlssstqasleidslfegidfytsitrarfeelcsd lfrstlepvekalrdakldkaqihdlvlvggstripkvqkllqdffngrdlnksinpdea vaygaavqaailm
Timeline for d5bpma2: